PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy020589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 600aa    MW: 67391.8 Da    PI: 5.4542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59545925PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS284.52.9e-872286002374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselyka.l.ppsetsekn.sseelaalklfsevsPilkfshlta 98 
                 e Ll+cAe v  +++ +a +lL++ +  +s++g+p++R+++yf+eAL+ r+  ++ +++++ l ++++ ++++ +++ + ++ +f+ + P+ +++ +t 
  Ahy020589 228 AESLLACAEKVGFKQFGRAGKLLSQCESSSSKTGSPVKRVVHYFAEALRLRIDLETGRISSKdLkKMQPMDPREiTKNLTPSVLAFYGAAPFCQITMFTL 327
                578*************************************************996666665414344444444534444555566*************** PP

       GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 q I e v +++++HiiDf+i +G+QW +L+q+L sR+  +   l+iT+vgs  s+sk  +e tg+rL++fA +l++++ ++ +++ ++ +l+ + ++++
  Ahy020589 328 VQSIIENVTEAKKIHIIDFEIRKGVQWTTLMQSLVSRNrCPLELLKITAVGS-GSNSKLIIEDTGKRLKDFAISLKINLCYDYVIVPDMLQLREDLFKID 426
                **************************************445569********.66799****************************************** PP

       GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                p+E+++V ++++l +  +++ +le     ++++vk+++P v+ ++e ea+hns+sF++rf+eal y+sa+fd+le+ + +++ +r + E ++l+  i+n+
  Ahy020589 427 PEETIVVYSQYALGSKIQQPDQLET----IMRVVKTIRPSVLAITEIEASHNSTSFVNRFIEALFYFSAFFDCLENCMKHDEPNRLVFESQYLAYGIKNI 522
                ************9999988888777....*********************************************************************** PP

       GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +a+egaer++r+ +   Wr+ ++++G+ ++++s     qa+l+ ++++ +   + + + +sl+lgWk+ pL s+S+W+
  Ahy020589 523 LAAEGAERNARNVRIDVWRAFFSRFGLVEAEISMLSLFQAELVAKRFPcGSSCTFDRDGNSLLLGWKGTPLNSISVWK 600
                ************************************************99999************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.922201579IPR005202Transcription factor GRAS
PfamPF035141.0E-84228600IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MENLSPFNEF GFSAIEDKHS SSNYTSWAIE GMNEVNKVQF SGAEEWGESM GIDPFGSSFE  60
FFPSQQQQQQ QLSYLEYGTL ESLQFVAVSP PPQTHTYFDD LHMFDENPTR MVPLSEETIA  120
NDKQQNSSTP LASLELLKSY GSNKGFKKLC DEEKIMQPID HSAAGNEVLG RKLSTDDVMR  180
IAGTRFIQSS PSSPKSLGSS ALKSIFSHPF GQFFSGLSGE EKEEVQLAES LLACAEKVGF  240
KQFGRAGKLL SQCESSSSKT GSPVKRVVHY FAEALRLRID LETGRISSKD LKKMQPMDPR  300
EITKNLTPSV LAFYGAAPFC QITMFTLVQS IIENVTEAKK IHIIDFEIRK GVQWTTLMQS  360
LVSRNRCPLE LLKITAVGSG SNSKLIIEDT GKRLKDFAIS LKINLCYDYV IVPDMLQLRE  420
DLFKIDPEET IVVYSQYALG SKIQQPDQLE TIMRVVKTIR PSVLAITEIE ASHNSTSFVN  480
RFIEALFYFS AFFDCLENCM KHDEPNRLVF ESQYLAYGIK NILAAEGAER NARNVRIDVW  540
RAFFSRFGLV EAEISMLSLF QAELVAKRFP CGSSCTFDRD GNSLLLGWKG TPLNSISVWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-402296006375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015959537.10.0PREDICTED: DELLA protein RGL3-like
TrEMBLA0A151R2H40.0A0A151R2H4_CAJCA; DELLA protein RGL2
STRINGGLYMA09G04110.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.15e-51RGA-like protein 3